Home

Epitope Prediction

1. Select MHC-I type(s) to be tested:

all supertype: A01 -- A01 -- A25 -- A26 -- A29 -- A30 -- A32 supertype: A02 -- A02 -- A6802 -- A69 supertype: A03 -- A03 -- A11 -- A31 -- A33 -- A34 -- A6801 -- A74 supertype: A24 -- A24 -- A23 supertype: B07 -- B07 -- B35 -- B42 -- B51 -- B53 -- B55 -- B56 -- B81 supertype: B27 -- B27 -- B14 -- B1503 -- B1510 -- B38 -- B39 supertype: B44 -- B44 -- B18 -- B37 -- B40 -- B45 -- B49 -- B50 supertype: B58 -- B58 -- B1516 -- B57 supertype: B62 -- B62 -- B13 -- B1501 -- B52 A05 A19 A28 A42 B08 B12 B17 B24 B46 B63 C01 C02 C03 C04 C05 C06 C07 C08 C12 C14 C15 C16 C18

2. Select length(s) of epitope to be tested:

all 8-mer 9-mer 10-mer 11-mer

3. Paste your sequences here (one per line):

MGARASVLSGGELDRWEKIRLRPGGKKKYKL

Windows source code and downloadable programs

Reference:
D. Heckerman, C. Kadie, and J. Listgarten, "Leveraging Information Across HLA Alleles/Supertypes Improves HLA-Specific Epitope Prediction," RECOMB 2006.